PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00674.80
Common NameJCGZ_16067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 340aa    MW: 38900.2 Da    PI: 5.6693
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00674.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.1e-28958150
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   krien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g+l  +s
  Jcr4S00674.80  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRLSLFS 58
                   79*******************************************98776 PP

2K-box18.48.8e-08125188870
          K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                    s +++a+ e+ qqe+ + k+++en+++++R l G+  + ++l e +  eq Le +l++ R +K+
  Jcr4S00674.80 125 SpATTAQLEEFQQEIVRFKSQLENMEKQLRILEGNLSHIITLPEAEYQEQILEGALNRMRMRKK 188
                    34788999***************************9999***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.025161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-30278IPR002100Transcription factor, MADS-box
CDDcd002655.15E-38275No hitNo description
PRINTSPR004044.6E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.7E-261055IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRLSLFSGN  60
KSIEEILTRY INIPEHERGR IEVLMVFLIF VAASWFHRLH NQEFLQKALG KLKAEGDQSN  120
FQATSPATTA QLEEFQQEIV RFKSQLENME KQLRILEGNL SHIITLPEAE YQEQILEGAL  180
NRMRMRKKFL EENYNSSAAP PASQVHLPPK TAYIDDFVTE ESPSNVLDWF HEREPQVQIL  240
NFLDSIGLQL PLRNQVQSGA EVLPTLVHGQ NINLDDHISP RSGLEEDNNV QRPEFGQVID  300
VNLSPWTEFY PTGNSSINAS QPRERAILEL YLSQMTPSTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D5e-17270168Myocyte-specific enhancer factor 2A
3mu6_C5e-17270168Myocyte-specific enhancer factor 2A
3mu6_B5e-17270168Myocyte-specific enhancer factor 2A
3mu6_A5e-17270168Myocyte-specific enhancer factor 2A
1tqe_S5e-17180179Myocyte-specific enhancer factor 2B
1tqe_R5e-17180179Myocyte-specific enhancer factor 2B
1tqe_Q5e-17180179Myocyte-specific enhancer factor 2B
1tqe_P5e-17180179Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572503.11e-172PREDICTED: agamous-like MADS-box protein AGL104 isoform X1
TrEMBLA0A067LAY60.0A0A067LAY6_JATCU; Uncharacterized protein
STRINGVIT_18s0001g09540.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.14e-52AGAMOUS-like 104
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]